Lixisenatide acetate salt,CAS:320367-13-3
Lixisenatide acetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-899 | 0.5mg | 250.00 | + Add to cart |
|
R-M-899 | 1mg | 440.00 | + Add to cart |
|
|
Product description
Lixisenatide acetate sal,CAS:320367-13-3 from ruixi.Lixisenatide is an exenatide-related GLP-1 agonist.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 320367-13-3 |
Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH₂ |
Synonyms | (Des-Pro³⁸)-Exendin-4(-Lys)₆ amide, ZP10 |
Molecular Formula | C₂₁₅H₃₄₇N₆₁O₆₅S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product